Rabbit anti-Human FBXW7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12677P

• Product Name:
• Rabbit anti-Human FBXW7 Polyclonal Antibody

• Synonym:
• AGO; CDC4; FBW6; FBW7; hAgo; FBX30; FBXW6; SEL10; hCdc4; DEDHIL; FBXO30; SEL-10; FBXW7

• Description:
• The antibody against FBXW7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 231-371 of human human， (NP_361014.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 231-371 of human human， (NP_361014.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FBXW7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELK

• Gene ID:
• 55294

• Uniprot-ID:
• Q969H0

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, 293F, Mouse brain, Rat brain