Rabbit anti-Human eIF4E Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12676P

• Product Name:
• Rabbit anti-Human eIF4E Polyclonal Antibody

• Synonym:
• CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1; 4E

• Description:
• The antibody against eIF4E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4E (NP_001959.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4E (NP_001959.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• eIF4E

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP

• Gene ID:
• 1977

• Uniprot-ID:
• P06730

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, HeLa, K-562, 293T