Rabbit anti-Human FSP1/S100A4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12678P

• Product Name:
• Rabbit anti-Human FSP1/S100A4 Polyclonal Antibody

• Synonym:
• 42A; 18A2; CAPL; FSP1; MTS1; P9KA; PEL98; FSP1/S100A4

• Description:
• The antibody against FSP1/S100A4 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-101 of human FSP1/S100A4 (NP_002952.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-101 of human FSP1/S100A4 (NP_002952.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FSP1/S100A4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

• Gene ID:
• 6275

• Uniprot-ID:
• P26447

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, A549, A-375, NIH/3T3