Rabbit anti-Human SDHB Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16426P

• Product Name:
• Rabbit anti-Human SDHB Monoclonal Antibody

• Synonym:
• SDHB; CWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP; succinate dehydrogenase complex iron sulfur subunit B

• Description:
• The antibody against SDHB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-280 of human SDHB (P21912) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 29-280 of human SDHB (P21912).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• SDHB

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV

• Gene ID:
• 6390

• Uniprot-ID:
• P21912

• Purification Method:
• SK-MEL-28, K-562, 293T, Mouse heart, Rat heart

• Positive Samples:
• Affinity purification