Rabbit anti-Human TEAD4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16425P

• Product Name:
• Rabbit anti-Human TEAD4 Monoclonal Antibody

• Synonym:
• TEAD4; EFTR-2; RTEF1; TCF13L1; TEF-3; TEF3; TEFR-1; hRTEF-1B; TEA domain transcription factor 4

• Description:
• The antibody against TEAD4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 140-240 of human TEAD4 (Q15561) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 140-240 of human TEAD4 (Q15561).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TEAD4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPD

• Gene ID:
• 7004

• Uniprot-ID:
• Q15561

• Purification Method:
• HepG2, Hela

• Positive Samples:
• Affinity purification