Rabbit anti-Human Claudin-4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16427P

• Product Name:
• Rabbit anti-Human Claudin-4 Monoclonal Antibody

• Synonym:
• CLDN4; CPE-R; CPER; CPETR; CPETR1; WBSCR8; hCPE-R; claudin-4; Claudin-4

• Description:
• The antibody against Claudin-4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 111-209 of human Claudin-4 (NP_001296.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 111-209 of human Claudin-4 (NP_001296.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Claudin-4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

• Gene ID:
• 1364

• Uniprot-ID:
• O14493

• Purification Method:
• MCF7, PC-3, MCF7

• Positive Samples:
• Affinity purification