Rabbit anti-Human HSP40 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16428P

• Product Name:
• Rabbit anti-Human HSP40 Monoclonal Antibody

• Synonym:
• DNAJB1; HSPF1; Hdj1; Hsp40; RSPH16B; Sis1; dnaJ homolog subfamily B member 1; HSP40

• Description:
• The antibody against HSP40 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 241-340 of human DNAJB1/HSP40 (NP_006136.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 241-340 of human DNAJB1/HSP40 (NP_006136.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• HSP40

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

• Gene ID:
• 3337

• Uniprot-ID:
• P25685

• Purification Method:
• 293T, Mouse testis, C2C12, Mouse plasma(Low expression control), Rat testis

• Positive Samples:
• Affinity purification