Rabbit anti-Human HOXD10 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16429P

• Product Name:
• Rabbit anti-Human HOXD10 Monoclonal Antibody

• Synonym:
• HOX4; HOX4D; HOX4E; Hox-4.4; HOXD10

• Description:
• The antibody against HOXD10 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-150 of human HOXD10 (NP_002139.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-150 of human HOXD10 (NP_002139.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• HOXD10

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPG

• Gene ID:
• 3236

• Uniprot-ID:
• P28358

• Purification Method:
• Mouse kidney

• Positive Samples:
• Affinity purification