Rabbit anti-Human Fos B Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15489P

• Product Name:
• Rabbit anti-Human Fos B Monoclonal Antibody

• Synonym:
• AP-1; G0S3; GOS3; GOSB; Fos B

• Description:
• The antibody against Fos B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Fos B(NP_006723.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Fos B(NP_006723.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Fos B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMP

• Gene ID:
• 2354

• Uniprot-ID:
• P53539

• Purification Method:
• HeLa treated by TPA

• Positive Samples:
• Affinity purification