Rabbit anti-Human Flt3/CD135 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15488P

• Product Name:
• Rabbit anti-Human Flt3/CD135 Monoclonal Antibody

• Synonym:
• FLK2; STK1; CD135; FLK-2; Flt3/CD135

• Description:
• The antibody against Flt3/CD135 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-163 of human Flt3/CD135 (NP_004110.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 27-163 of human Flt3/CD135 (NP_004110.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Flt3/CD135

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNT

• Gene ID:
• 2322

• Uniprot-ID:
• P36888

• Purification Method:
• Reh

• Positive Samples:
• Affinity purification