Rabbit anti-Human CD84 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15490P

• Product Name:
• Rabbit anti-Human CD84 Monoclonal Antibody

• Synonym:
• LY9B; hCD84; mCD84; SLAMF5; CD84

• Description:
• The antibody against CD84 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-225 of human CD84 (NP_001171808.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-225 of human CD84 (NP_001171808.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD84

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTG

• Gene ID:
• 8832

• Uniprot-ID:
• Q9UIB8

• Purification Method:
• Raji

• Positive Samples:
• Affinity purification