Rabbit anti- Cas9 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15079P

• Product Name:
• Rabbit anti- Cas9 Monoclonal Antibody

• Synonym:
• CAS9; Cas9

• Description:
• The antibody against Cas9 was raised in Rabbit using the recombinant protein of streptococcus pyogenes m1 Cas9 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of streptococcus pyogenes m1 Cas9.

• Species Reactivity:
• Human, Other (Wide Range Predicted)

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Cas9

• Form:
• Liquid

• Immunogen Sequence:
• YVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSP

• Gene ID:
• 901176

• Uniprot-ID:
• Q99ZW2

• Purification Method:
• 293T, 293T-Cas9

• Positive Samples:
• Affinity purification