Rabbit anti-Human IL15 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15080P

• Product Name:
• Rabbit anti-Human IL15 Monoclonal Antibody

• Synonym:
• IL-15; IL15

• Description:
• The antibody against IL15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 49-162 of human IL15 (NP_000576.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 49-162 of human IL15 (NP_000576.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• IL15

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

• Gene ID:
• 3600

• Uniprot-ID:
• P40933

• Positive Samples:
• Affinity purification