Rabbit anti-Human Histone H4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15078P

• Product Name:
• Rabbit anti-Human Histone H4 Monoclonal Antibody

• Synonym:
• H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Histone H4

• Description:
• The antibody against Histone H4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4(NP_003529.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ChIP-seq, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4(NP_003529.1)

• Species Reactivity:
• Human, Mouse, Rat, Other (Wide Range Predicted)

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ChIP, ChIP-seq, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Histone H4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG

• Gene ID:
• 8359

• Uniprot-ID:
• P62805

• Purification Method:
• HeLa, C2C12

• Positive Samples:
• Affinity purification