Rabbit Anti-ZNF585B Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49776P

• Product Name:
• Rabbit Anti-ZNF585B Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within N terminal aa 107-156 (RKIIGYKPASSQDQKIYSGEKSYECAEFGKSFTWKSQFKVHLKVPTGEK L) of Human ZNF585B, NP_689492

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: None Constituents: 2% Sucrose, PBS

• Clonality:
• Polyclonal

• Form:
• Liquid