• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZNF583 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-49775P
  • Product Name:
  • Rabbit Anti-ZNF583 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide, corresponding to a region within internal aa 271-320 ( ECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRIHTGE ) of Mouse ZNF583 (NP_001028421). Run BLAST with Run BLAST with
  • Species Reactivity:
  • Mouse Predicted to work with: Rat, Rabbit, Horse, Cow, Dog, Human, Zebrafish
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • Constituents: 97% PBS, 2% Sucrose
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-ZNF583 Polyclonal Antibody-FPA-49774P
  • Online Inquiry

    refresh