Rabbit Anti-ZNF583 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49775P

• Product Name:
• Rabbit Anti-ZNF583 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within internal aa 271-320 ( ECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRIHTGE ) of Mouse ZNF583 (NP_001028421). Run BLAST with Run BLAST with

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Cow, Dog, Human, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 97% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid