Rabbit Anti-ZDHHC20 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49545P

• Product Name:
• Rabbit Anti-ZDHHC20 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZDHHC20 aa 301-350 (C terminal). The exact sequence is proprietary. Sequence: PEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGI Database link: Q5W0Z9 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Horse, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid