Rabbit Anti-ZDHHC19 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49544P

• Product Name:
• Rabbit Anti-ZDHHC19 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZDHHC19 aa 48-97 (N terminal). The exact sequence is proprietary. Sequence: FPCRWLAQNGEWAFPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPL Database link: Q8WVZ1 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid