Cat#:FPA-49466P;Product Name:Rabbit Anti-WWOX Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human WWOX aa 1-50 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTG Database link: Q9NZC7 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P;Storage Buffer:Protein A purified;Storage Procedures:Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol;
Synthetic peptide within Human WWOX aa 1-50 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTG Database link: Q9NZC7 Run BLAST with Run BLAST with