Rabbit Anti-WWOX Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49465P

• Product Name:
• Rabbit Anti-WWOX Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human WWOX aa 364-414. The exact sequence is proprietary. NP_057457.1 Sequence: AVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQS G Database link: Q9NZC7 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Orangutan

• Isotype:
• IgG

• Application:
• IP

• Storage Buffer:
• Immunogen affinity purified

• Clonality:
• Polyclonal

• Form:
• Liquid