Rabbit Anti-VDAC1/Porin Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-44134P

• Product Name:
• Rabbit Anti-VDAC1/Porin Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human VDAC1/Porin aa 1-30 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: MAVPPTYADLGKSARDVFTKGYGFGLIKLD

• Species Reactivity:
• Mouse, Human

• Isotype:
• IgG

• Application:
• ICC/IF, WB, IHC-P, Flow Cyt

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at -20°C.

• Clonality:
• Polyclonal

• Form:
• Liquid