Cat#:FPA-44130P;Product Name:Rabbit Anti-VDAC1/Porin Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human VDAC1/Porin aa 234-283 (C terminal). Sequence: SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish;Isotype:IgG;Application:IHC-P, WB, ELISA;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;