Rabbit Anti-TRIM21 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48964P

• Product Name:
• Rabbit Anti-TRIM21 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human TRIM21 aa 250-300 (internal sequence). Sequence: VLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPW L Database link: NP_003132.2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Chimpanzee, Gorilla

• Isotype:
• IgG

• Application:
• IP

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: 0.09% Sodium Azide Constituents: Tris citrate/phosphate, pH 7.0-8.0

• Clonality:
• Polyclonal

• Form:
• Liquid