• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TRIM21 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-48964P
  • Product Name:
  • Rabbit Anti-TRIM21 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Human TRIM21 aa 250-300 (internal sequence). Sequence: VLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPW L Database link: NP_003132.2 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human Predicted to work with: Chimpanzee, Gorilla
  • Isotype:
  • IgG
  • Application:
  • IP
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • Preservative: 0.09% Sodium Azide Constituents: Tris citrate/phosphate, pH 7.0-8.0
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TRIM21 Polyclonal Antibody-FPA-48963P
  • Online Inquiry

    refresh