• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TRIM21 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-42806P
  • Product Name:
  • Rabbit Anti-TRIM21 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Human TRIM21 aa 425-475 (C terminal). Sequence: DHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTD Y
  • Species Reactivity:
  • Human Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla
  • Isotype:
  • IgG
  • Application:
  • WB, IP, ICC/IF
  • Storage Buffer:
  • Preservative: 0.09% Sodium Azide Constituents: 0.1% BSA, Tris buffered saline
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TRIM17 Polyclonal Antibody-FPA-42805P
  • Online Inquiry

    refresh