• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TRAP100 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-42694P
  • Product Name:
  • Rabbit Anti-TRAP100 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Human TRAP100 aa 939-989. Sequence: RGSVLQFMPFTTVSELVKVSAMSSPKVVLAITDLSLPLGRQVAAKAIAAL
  • Species Reactivity:
  • Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Isotype:
  • IgG
  • Application:
  • WB, IP
  • Storage Buffer:
  • Preservative: 0.09% Sodium Azide Constituents: 8mM PBS, 60mM Citrate, 150mM Tris, pH 7 to 8
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TRAP100 Polyclonal Antibody-FPA-42693P
  • Online Inquiry

    refresh