Rabbit Anti-TRAP100 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42694P

• Product Name:
• Rabbit Anti-TRAP100 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human TRAP100 aa 939-989. Sequence: RGSVLQFMPFTTVSELVKVSAMSSPKVVLAITDLSLPLGRQVAAKAIAAL

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: 8mM PBS, 60mM Citrate, 150mM Tris, pH 7 to 8

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid