Rabbit Anti-TRAP100 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42692P

• Product Name:
• Rabbit Anti-TRAP100 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TRAP100 aa 801-850. The exact sequence is proprietary. Synthetic peptide around Lys834 of Human TRAP100. Sequence: LMDPPGTALAKLAVWCALSSYSSHKGQASTRQKKRHREDIEDYISLFPLD

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, WB, ICC/IF

• Storage Buffer:
• pH: 7.2 Preservative: 0.05% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid