Rabbit Anti-TMEM221 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48844P

• Product Name:
• Rabbit Anti-TMEM221 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TMEM221 aa 177-226 (C terminal). The exact sequence is proprietary. Sequence: RAARRGLHELSPPSFEDDLARPAEVSKASPRAQPQQGIHRRTPYSTCPEP Database link: A6NGB7 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid