Cat#:FPA-48843P;Product Name:Rabbit Anti-TMEM215 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TMEM215 aa 76-125 (N terminal). The exact sequence is proprietary. (NP_997723). Sequence: WVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQS Database link: Q68D42 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 98% PBS, 2% Sucrose;
Synthetic peptide within Human TMEM215 aa 76-125 (N terminal). The exact sequence is proprietary. (NP_997723). Sequence: WVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQS Database link: Q68D42 Run BLAST with Run BLAST with
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog