Rabbit Anti-TMEM182 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48831P

• Product Name:
• Rabbit Anti-TMEM182 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TMEM182 aa 67-116 (N terminal). The exact sequence is proprietary. NP_653233 Sequence: ENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFW Database link: Q6ZP80 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Clonality:
• Polyclonal

• Form:
• Liquid