Rabbit Anti-TMEM177 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48830P

• Product Name:
• Rabbit Anti-TMEM177 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TMEM177 aa 241-290 (C terminal). The exact sequence is proprietary. Sequence: AYACGGVEFYEKLLSGNLALRSLLGKDGEKLYTPSGNIVPRHLFRIKHLP Database link: Q53S58 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Guinea pig, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid