Rabbit Anti-STAT5b Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-40255P

• Product Name:
• Rabbit Anti-STAT5b Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a region within N terminal aa 2-51( AVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNP ) of Human STAT5b (NP_036580)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid