Rabbit Anti-STAT5b Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-40254P

• Product Name:
• Rabbit Anti-STAT5b Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the N terminal aa 179-228 (LRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVE L) of Human STAT5b (NP_036580).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Sheep, Cow, Dog, Pig

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid