Rabbit Anti-SHB Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-38075P

• Product Name:
• Rabbit Anti-SHB Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the N terminal aa 1-50, MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA , of Human SHB (NP_003019)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid