Cat#:FPA-38074P;Product Name:Rabbit Anti-SHB Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human SHB aa 340-400. Sequence: WEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSP EFCGILGERVD ;Species Reactivity:Human Predicted to work with: Mouse;Isotype:IgG;Application:ICC/IF;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;