Cat#:FPA-37660P;Product Name:Rabbit Anti-SEPT7 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human SEPT7 aa 350-399. NP_001779.3. Sequence: MKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEE ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Chimpanzee, Orangutan;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS (without Mg2+, Ca2+);Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;