• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-SEPT7 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-37659P
  • Product Name:
  • Rabbit Anti-SEPT7 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human SEPT7 aa 75-125. The exact sequence is proprietary. NP_001779.3 Sequence: LYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNS N
  • Species Reactivity:
  • Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan
  • Isotype:
  • IgG
  • Application:
  • IP, WB
  • Storage Buffer:
  • pH: 7 Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7.0-8.0
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-SEPT7 Polyclonal Antibody-FPA-37658P
  • Online Inquiry

    refresh