Rabbit Anti-SEPT7 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37659P

• Product Name:
• Rabbit Anti-SEPT7 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human SEPT7 aa 75-125. The exact sequence is proprietary. NP_001779.3 Sequence: LYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNS N

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan

• Isotype:
• IgG

• Application:
• IP, WB

• Storage Buffer:
• pH: 7 Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7.0-8.0

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid