Rabbit Anti-SEP15 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37627P

• Product Name:
• Rabbit Anti-SEP15 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide within residues VRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEF corresponding to aa 109-158 of Human SEP15 (NP_004252)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Cow, Cat, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid