Cat#:FPA-37626P;Product Name:Mouse Anti-Sensor Histidine Kinase Polyclonal Antibody;Host Species:Mouse ;Immunogen:Fusion protein: RALDKVLTNLISNAIKYSDKNGRVIISEQDGYLSIKNTCAPLSDQELEHL FDIFYHSQIVTDKDESSGLGLYIVNNILESYQMDYSFLPYEHGMEFKISL , corresponding to aa 344/443 of Sensor Histidine Kinase (SP2192 Streptococcus pneumoniae TIGR4) . ;Species Reactivity:Reacts with Streptococcus pneumonie TIGR4 and Streptococcus agalactiae. Not yet tested in other specie.;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 50% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.;