Rabbit Anti-SDF1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37411P

• Product Name:
• Rabbit Anti-SDF1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human SDF1 aa 63-92 (C terminal) conjugated to keyhole limpet haemocyanin. Synthetic peptide conjugated to KLH, corresponding to a region within C terminal aa 63-92 (LKNNNRQVCIDPKLKWIQEYLEKALNKRFK) of Human SDF1 (UniProt

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid