Rabbit Anti-SDF1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37409P

• Product Name:
• Rabbit Anti-SDF1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human SDF1 aa 44-93. A region within synthetic peptide: VKHLKILNTP NCALQIVARL KNNNRQVCID PKLKWIQEYL EKALNKRFKM, corresponding to aa 44-93 of Human SDF1 Sequence: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid