• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Salivary alpha amylase Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-48246P
  • Product Name:
  • Rabbit Anti-Salivary alpha amylase Polyclonal Antibody
  • Formulation:
  • Lyophilised:Add 1.0 ml sterile distilled water. Spin down to remove insoluble particles.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Tissue, cells or virus corresponding to Bacillus subtilis Salivary alpha amylase aa 42-659. Isolated and purified from Bacillus subtilis. Sequence: LTAPSIKSGTILHAWNWSFNTLKHNMKDIHDAGYTAIQTSPINQVKEGNQ GDKSMSNWYWLYQPTSYQIGNRYLGTEQEFKEMCAAAEEYGIKVIVDAVI NHTTS
  • Species Reactivity:
  • Other
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • IgG fraction
  • Clonality:
  • Polyclonal
  • Pre product:Rabbit Anti-Saccharomyces cerevisiae Polyclonal Antibody-FPA-48245P
  • Online Inquiry

    refresh