Rabbit Anti-Salivary alpha amylase Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37026P

• Product Name:
• Rabbit Anti-Salivary alpha amylase Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Rat Salivary alpha amylase aa 301-350 (internal sequence). Sequence: YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Chicken, Dog, Human, Pig, Drosophila melanogaster

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid