Rabbit Anti-PPAP2A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-33136P

• Product Name:
• Rabbit Anti-PPAP2A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human PPAP2A aa 31-80 (N terminal). The exact sequence is proprietary. Isoform 2 Sequence: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV

• Species Reactivity:
• Human Predicted to work with: Rat, Guinea pig, Cat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid