Cat#:FPA-33135P;Product Name:Rabbit Anti-PPAN Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human PPAN aa 375-425. The exact sequence is proprietary. NP_064615.3. Sequence: LGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEM D ;Species Reactivity:Human Predicted to work with: Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan;Isotype:IgG;Application:WB, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human PPAN aa 375-425. The exact sequence is proprietary. NP_064615.3. Sequence: LGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEM D
Species Reactivity:
Human Predicted to work with: Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
Isotype:
IgG
Application:
WB, IP
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: