Rabbit Anti-Mps1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-26501P

• Product Name:
• Rabbit Anti-Mps1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide: DVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQ D , corresponding to aa 700 to 750 of Human Mps1

• Species Reactivity:
• Mouse, Human Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Dog, Chimpanzee, Ferret, Cynomolgus monkey, Rhesus monkey, Orangutan, Bat

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: 8mM PBS, 60mM Citrate, 150mM Tris, pH 7-8

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid