• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Mps1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-26501P
  • Product Name:
  • Rabbit Anti-Mps1 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide: DVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQ D , corresponding to aa 700 to 750 of Human Mps1
  • Species Reactivity:
  • Mouse, Human Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Dog, Chimpanzee, Ferret, Cynomolgus monkey, Rhesus monkey, Orangutan, Bat
  • Isotype:
  • IgG
  • Application:
  • WB, IP
  • Storage Buffer:
  • Preservative: 0.09% Sodium Azide Constituents: 8mM PBS, 60mM Citrate, 150mM Tris, pH 7-8
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Mps1 Polyclonal Antibody-FPA-26500P
  • Online Inquiry

    refresh