• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Mps1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-26500P
  • Product Name:
  • Rabbit Anti-Mps1 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide: LVGLNSPNSILKAAKTLYEHYSGGESHNSSSSKTFEKKRGKK , corresponding to C terminal aa 800-841 of Human Mps1
  • Species Reactivity:
  • Human Predicted to work with: Chimpanzee, Gorilla
  • Isotype:
  • IgG
  • Application:
  • ICC/IF, WB, IP
  • Storage Buffer:
  • Preservative: 0.09% Sodium Azide Constituents: 8mM PBS, 60mM Citrate, 150mM Tris, pH 7-8
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Mps1 Polyclonal Antibody-FPA-26499P
  • Online Inquiry

    refresh