Rabbit Anti-METTL3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-25834P

• Product Name:
• Rabbit Anti-METTL3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human METTL3 aa 503-552 (internal sequence). Sequence: IVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLD

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae, Drosophila melanogaster, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid