Product finder
Cat#:FPA-25832P;Product Name:Rabbit Anti-METTL3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human METTL3 aa 1-50 (N terminal). Sequence: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish;Isotype:IgG;Application:WB, IHC-P, ELISA;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;
Rabbit Anti-METTL3 Polyclonal Antibody
Online Inquiry
- Product Name:
- Rabbit Anti-METTL3 Polyclonal Antibody
- Immunogen:
- Synthetic peptide corresponding to Human METTL3 aa 1-50 (N terminal). Sequence: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS
- Species Reactivity:
- Human Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
- Application:
- WB, IHC-P, ELISA
- Storage Buffer:
- Preservative: None Constituents: 2% Sucrose, PBS
- Storage Procedures:
- Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Pre product:Rabbit Anti-METTL2B Polyclonal Antibody-FPA-25831P
Next product:Rabbit Anti-METTL3 Polyclonal Antibody-FPA-25833P