Rabbit Anti-IL8 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-47275P

• Product Name:
• Rabbit Anti-IL8 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein corresponding to Pig IL8 aa 26-103. Sequence: ARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKE VCLDPKEKWV QKVVQIFLKRTEKQQQQQ Database link: P26894 Run BLAST with Run BLAST with

• Species Reactivity:
• Pig Predicted to work with: Sheep, Rabbit, Cow, Dog

• Isotype:
• IgG

• Application:
• ELISA, WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid