• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-IL8 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-47273P
  • Product Name:
  • Rabbit Anti-IL8 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant full length protein corresponding to Cow IL8 aa 23-101. Sequence: AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTN GNEVCLNPKEKWVQKVVQVFVKRAEKQDP Database link: P79255 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Cow Predicted to work with: Sheep, Dog, Pig
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • Preservative: 0.09% Sodium azide Constituent: 99% PBS
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-IL7 Polyclonal Antibody-FPA-47272P
  • Online Inquiry

    refresh